Protein Info for Psest_0556 in Pseudomonas stutzeri RCH2

Annotation: Curlin associated repeat.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF07012: Curlin_rpt" amino acids 136 to 166 (31 residues), 26.1 bits, see alignment 3.4e-10 amino acids 179 to 210 (32 residues), 27.5 bits, see alignment 1.2e-10 amino acids 188 to 221 (34 residues), 35.9 bits, see alignment 2.8e-13 amino acids 210 to 242 (33 residues), 32.4 bits, see alignment 3.5e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GEK3 at UniProt or InterPro

Protein Sequence (242 amino acids)

>Psest_0556 Curlin associated repeat. (Pseudomonas stutzeri RCH2)
MFKINALFAAVLAVSATQAFAASSEAVIEQNGFDQVADVYQEGVGQASYIYQSGASQQNA
ATTTQTGQDNFSEVTQQGALHQADVIQTGVEGRVIISQYDVNNSTLVEQAGLANSADITQ
DGLNNDVVLIQDNAFNDTVVDQFGEGNEALISQTGQEGIIDVSQAGNMNVADIAQEGLAN
SVDLMQQGDGNLALVDQFGEANQAVVMQNGMDNFANVTQAGFADYANISQTGSNNTAIIT
QQ