Protein Info for PGA1_c05610 in Phaeobacter inhibens DSM 17395

Annotation: putative queuosine biosynthesis protein QueD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 TIGR03367: queuosine biosynthesis protein QueD" amino acids 3 to 93 (91 residues), 93.1 bits, see alignment E=5.5e-31 PF01242: PTPS" amino acids 4 to 116 (113 residues), 109.8 bits, see alignment E=4.3e-36

Best Hits

Swiss-Prot: 33% identical to QUED_ARCFU: Putative 6-carboxy-5,6,7,8-tetrahydropterin synthase (queD) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: K01737, 6-pyruvoyl tetrahydrobiopterin synthase [EC: 4.2.3.12] (inferred from 88% identity to pde:Pden_4184)

Predicted SEED Role

"6-carboxytetrahydropterin synthase (EC 4.1.2.50) @ Queuosine biosynthesis QueD, PTPS-I" (EC 4.1.2.50)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.50 or 4.2.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DMH5 at UniProt or InterPro

Protein Sequence (117 amino acids)

>PGA1_c05610 putative queuosine biosynthesis protein QueD (Phaeobacter inhibens DSM 17395)
MFRITKEFHFSASHQLSHLPADHQCARLHGHNYIVVVELAGAELNSDGFVRDYHELAPLK
NYIDGSFDHRHLNDVMDGPSTAENMARHFYEWCVARWPETSAVRVSETPKTWAEYRP