Protein Info for PGA1_c05610 in Phaeobacter inhibens DSM 17395

Annotation: putative queuosine biosynthesis protein QueD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03367: queuosine biosynthesis protein QueD
  • amino acids 3 to 93 (91 residues), 93.1 bits, E=5.5e-31
• PF01242: PTPS
  • amino acids 4 to 116 (113 residues), 109.7 bits, E=4.4e-36

Best Hits

Swiss-Prot: 33% identical to QUED_ARCFU: Putative 6-carboxy-5,6,7,8-tetrahydropterin synthase (queD) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: K01737, 6-pyruvoyl tetrahydrobiopterin synthase [EC: 4.2.3.12] (inferred from 88% identity to pde:Pden_4184)

Predicted SEED Role

"6-carboxytetrahydropterin synthase (EC 4.1.2.50) @ Queuosine biosynthesis QueD, PTPS-I" (EC 4.1.2.50)

MetaCyc Pathways

• drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
• erythro-tetrahydrobiopterin biosynthesis I (2/4 steps found)
• threo-tetrahydrobiopterin biosynthesis (2/4 steps found)
• preQ₀ biosynthesis (2/4 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.50 or 4.2.3.12

Sequence Analysis Tools

See I7DMH5 at UniProt or InterPro

Protein Sequence (117 amino acids)

>PGA1_c05610 putative queuosine biosynthesis protein QueD (Phaeobacter inhibens DSM 17395)
MFRITKEFHFSASHQLSHLPADHQCARLHGHNYIVVVELAGAELNSDGFVRDYHELAPLK
NYIDGSFDHRHLNDVMDGPSTAENMARHFYEWCVARWPETSAVRVSETPKTWAEYRP