Protein Info for HP15_535 in Marinobacter adhaerens HP15

Annotation: sulfite oxidase subunit YedY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 signal peptide" amino acids 1 to 48 (48 residues), see Phobius details PF00174: Oxidored_molyb" amino acids 100 to 258 (159 residues), 109.1 bits, see alignment E=9.4e-36

Best Hits

Swiss-Prot: 63% identical to MSRP_XANCP: Protein-methionine-sulfoxide reductase catalytic subunit MsrP (msrP) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K07147, (no description) (inferred from 80% identity to maq:Maqu_0886)

MetaCyc: 55% identical to protein-L-methionine sulfoxide reductase catalytic subunit MsrP (Escherichia coli K-12 substr. MG1655)
1.8.5.M7 [EC: 1.8.5.M7]; 1.8.5.M7 [EC: 1.8.5.M7]

Predicted SEED Role

"Putative sulfite oxidase subunit YedY"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.5.M7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNI1 at UniProt or InterPro

Protein Sequence (324 amino acids)

>HP15_535 sulfite oxidase subunit YedY (Marinobacter adhaerens HP15)
MLIKKRPSWALPHSEVTPESVYLNRRQFMSGTLAVAAGLSVPGLLSAAKLPVPGEALDFV
PMPGFSTDEEKTPFEDVTRYNNFYEFGTGKGDPAKYADEMTVDPWSVVVEGECDRPGAYA
LEDLLKPHEYQERVYRLRCVEAWSMVIPWIGIPLVDILKRLEPTSRAKYVYFETLYDPDQ
MRGQRSLFSTIDWPYQEGLRMDEAMNELSFLAVGLYGKTMPNQNGAPIRLVVPWKYGFKS
IKSIVKIRFQEERPKTTWEMLAPQEYGFYANVNPEVDHPRWSQKRERRLPSGLLSPNYME
TVKFNGYGEQVADLYKGMDLSKFY