Protein Info for PGA1_c05560 in Phaeobacter inhibens DSM 17395

Annotation: glycine cleavage system protein GcvH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00527: glycine cleavage system H protein
  • amino acids 1 to 117 (117 residues), 145.8 bits, E=3.6e-47
• PF01597: GCV_H
  • amino acids 2 to 118 (117 residues), 144.6 bits, E=7.1e-47

Best Hits

Swiss-Prot: 61% identical to GCSH_SINFN: Glycine cleavage system H protein (gcvH) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 83% identity to sit:TM1040_2392)

MetaCyc: 54% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

Sequence Analysis Tools

See I7EJG7 at UniProt or InterPro

Protein Sequence (120 amino acids)

>PGA1_c05560 glycine cleavage system protein GcvH (Phaeobacter inhibens DSM 17395)
MKFTEEHEWLLPEGDDLITVGITSHAAEQLGDVVFVELPEVGTEVSMDDEIVVIESVKAA
SDILAPLDGEIVEVNEALADNPGKINEDPQGDAWFFKIKPADLSPMDDYMDEAGYKDFIG