Protein Info for Psest_0547 in Pseudomonas stutzeri RCH2

Annotation: Urease accessory protein UreF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01730: UreF" amino acids 41 to 187 (147 residues), 131.3 bits, see alignment E=1.9e-42

Best Hits

Swiss-Prot: 77% identical to UREF_PSEMY: Urease accessory protein UreF (ureF) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K03188, urease accessory protein (inferred from 91% identity to psa:PST_3737)

Predicted SEED Role

"Urease accessory protein UreF" in subsystem Urea decomposition

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIL5 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Psest_0547 Urease accessory protein UreF (Pseudomonas stutzeri RCH2)
MNATAAPGSAWALLRLASPQLPIGGYSYSQGLEMAVENGWVNDSDSARRWLEDQLLLNLA
RFEAPLLLAHCEAAAQDDWPRLLQLAAEHRASRETRELQLESRQMGYSLTQLLDGLPELD
QQARDCFASAGEPGLAMAWALAARAWQITPADALAAWLWGWLENQLAVLMKTLPLGQQAA
QRLTSGLLPVLSQAQREASELPEAAWGSAPLGLVLTSMAHERQYSRLFRS