Protein Info for PGA1_c05490 in Phaeobacter inhibens DSM 17395

Annotation: ureidoglycolate hydrolase AllA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF04115: Ureidogly_lyase" amino acids 1 to 158 (158 residues), 189.5 bits, see alignment E=1.7e-60

Best Hits

Swiss-Prot: 58% identical to ALLA_RHOCB: Ureidoglycolate lyase (allA) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K01483, ureidoglycolate hydrolase [EC: 3.5.3.19] (inferred from 72% identity to sil:SPO0873)

Predicted SEED Role

"Ureidoglycolate hydrolase (EC 3.5.3.19)" in subsystem Allantoin Utilization (EC 3.5.3.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DMG5 at UniProt or InterPro

Protein Sequence (161 amino acids)

>PGA1_c05490 ureidoglycolate hydrolase AllA (Phaeobacter inhibens DSM 17395)
MKTVEIRPISAEGFAPFGDLIDCTGAPDKIINQGLCGRYHDRAQLAFTTGRAGLSLFNAE
PRALPMPLLMVERHPEGSQAFIPMSETGFLVIVAPDAGGAPGQPLAFETQPGQAINFHRG
TWHGVLTPLTAPGLFAVVDRIGDGANLEEHWFDTPYQVIRP