Protein Info for Psest_0540 in Pseudomonas stutzeri RCH2

Annotation: Ion transport protein.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 129 to 157 (29 residues), see Phobius details amino acids 177 to 191 (15 residues), see Phobius details amino acids 202 to 227 (26 residues), see Phobius details PF00520: Ion_trans" amino acids 26 to 235 (210 residues), 132.9 bits, see alignment E=1.2e-42 PF08016: PKD_channel" amino acids 107 to 233 (127 residues), 27.9 bits, see alignment E=1.6e-10

Best Hits

KEGG orthology group: K08714, voltage-gated sodium channel (inferred from 90% identity to psa:PST_3753)

Predicted SEED Role

"Voltage-gated sodium channel subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHA5 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Psest_0540 Ion transport protein. (Pseudomonas stutzeri RCH2)
MQATPVETSTRSRLKQLIERPAVQRGILLLIVINAAILGMQTSPSLVASWGEFLRVLDML
ILGVFVVEIAARIYVHRAAFFRDPWSLFDFTVVAIALVPASGPFSVLRALRVLRVMRMVT
MVPSMRRVVGALLSAIPGLGSIAMVLALVFYVSAVIATGLFGADFPEWFGNLGRSVYTLF
QVMTLESWSMGIVRPLMDVFPYAWVFFIPFILIATFTMLNLFIAIIVNAMQTVTDADHEA
TQATIEAAREHIEADLHEEVRALRGEIAELKELLRGQARR