Protein Info for PGA1_c05470 in Phaeobacter inhibens DSM 17395
Annotation: hydroxyisourate hydrolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 62% identical to HIUH_RHILO: 5-hydroxyisourate hydrolase (mlr5133) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
KEGG orthology group: K07127, 5-hydroxyisourate hydrolase [EC: 3.5.2.17] (inferred from 72% identity to sil:SPO0871)Predicted SEED Role
No annotation
MetaCyc Pathways
- ureide biosynthesis (6/7 steps found)
- urate conversion to allantoin I (2/3 steps found)
- superpathway of purines degradation in plants (12/18 steps found)
- urate conversion to allantoin II (1/3 steps found)
- urate conversion to allantoin III (1/3 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.5.2.17
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See I7DXX7 at UniProt or InterPro
Protein Sequence (123 amino acids)
>PGA1_c05470 hydroxyisourate hydrolase (Phaeobacter inhibens DSM 17395) MTTRTEPGYLTTHVLDTARGCPAAGLPIRLYRLDGRGRTELASMLTNADGRTDSPILPKK DFVTGNYELVFEAGEYLRASGQASGEVLFLDDVPIRFGITDDSAHYHVPLLLSPFGYSTY RGS