Protein Info for PGA1_c05470 in Phaeobacter inhibens DSM 17395

Annotation: hydroxyisourate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02962: hydroxyisourate hydrolase
  • amino acids 9 to 123 (115 residues), 129.9 bits, E=2.8e-42
• PF00576: Transthyretin
  • amino acids 10 to 122 (113 residues), 129 bits, E=5.8e-42

Best Hits

Swiss-Prot: 62% identical to HIUH_RHILO: 5-hydroxyisourate hydrolase (mlr5133) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K07127, 5-hydroxyisourate hydrolase [EC: 3.5.2.17] (inferred from 72% identity to sil:SPO0871)

Predicted SEED Role

No annotation

MetaCyc Pathways

• ureide biosynthesis (6/7 steps found)
• urate conversion to allantoin I (2/3 steps found)
• superpathway of purines degradation in plants (12/18 steps found)
• urate conversion to allantoin II (1/3 steps found)
• urate conversion to allantoin III (1/3 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.17

Sequence Analysis Tools

See I7DXX7 at UniProt or InterPro

Protein Sequence (123 amino acids)

>PGA1_c05470 hydroxyisourate hydrolase (Phaeobacter inhibens DSM 17395)
MTTRTEPGYLTTHVLDTARGCPAAGLPIRLYRLDGRGRTELASMLTNADGRTDSPILPKK
DFVTGNYELVFEAGEYLRASGQASGEVLFLDDVPIRFGITDDSAHYHVPLLLSPFGYSTY
RGS