Protein Info for Psest_0529 in Pseudomonas stutzeri RCH2

Annotation: Putative Mg2+ and Co2+ transporter CorC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 PF21917: NMB0537_N" amino acids 23 to 58 (36 residues), 55.4 bits, see alignment 5.7e-19 PF00571: CBS" amino acids 63 to 120 (58 residues), 25.7 bits, see alignment E=1.8e-09 amino acids 131 to 184 (54 residues), 29.2 bits, see alignment E=1.5e-10 PF03471: CorC_HlyC" amino acids 203 to 277 (75 residues), 75.9 bits, see alignment E=3.1e-25

Best Hits

Swiss-Prot: 52% identical to CORC_ECOLI: Magnesium and cobalt efflux protein CorC (corC) from Escherichia coli (strain K12)

KEGG orthology group: K06189, magnesium and cobalt transporter (inferred from 99% identity to psa:PST_3764)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGK4 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Psest_0529 Putative Mg2+ and Co2+ transporter CorC (Pseudomonas stutzeri RCH2)
MSEDRSISGQKTWLERITQAFAHEPKNRQELLEVLREAHQNKLLDNEALAIVEGAIQVAD
LQVRDIMVPRSQVISIRADQSPREFLPAIIAAAHSRYPVVGESLDEVIGVLLAKDLLPLI
LKEDQQNFDIKDLLRPATFVPESKRLNVLLREFRANHNHMAIVIDEYGGVAGLVTIEDVL
EQIVGDIEDEHDVEEDSYIRPLPSGDFLVKALTPIDSFNEYFGSAFPDDEFDTVAGLVMS
TFGHLPKRNEVTEIDGFRVRVLNADSRRVHMLRLSRTESA