Protein Info for PGA1_c00520 in Phaeobacter inhibens DSM 17395

Annotation: tRNA (guanine-N(1)-)-methyltransferase TrmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR00088: tRNA (guanine(37)-N(1))-methyltransferase" amino acids 35 to 265 (231 residues), 275.7 bits, see alignment E=1.3e-86 PF01746: tRNA_m1G_MT" amino acids 55 to 253 (199 residues), 179.6 bits, see alignment E=3e-57

Best Hits

Swiss-Prot: 87% identical to TRMD_RUEST: tRNA (guanine-N(1)-)-methyltransferase (trmD) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K00554, tRNA (guanine-N1-)-methyltransferase [EC: 2.1.1.31] (inferred from 85% identity to sit:TM1040_2611)

MetaCyc: 46% identical to tRNA m1G37 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-12458 [EC: 2.1.1.228]

Predicted SEED Role

"tRNA (Guanine37-N1) -methyltransferase (EC 2.1.1.31)" in subsystem Ribosome biogenesis bacterial or Wyeosine-MimG Biosynthesis (EC 2.1.1.31)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.228 or 2.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EVI7 at UniProt or InterPro

Protein Sequence (266 amino acids)

>PGA1_c00520 tRNA (guanine-N(1)-)-methyltransferase TrmD (Phaeobacter inhibens DSM 17395)
MSAQNKSHGRKAIRPSFKPRELMTPTPDLVGVWKAKIMTLFPNAFPGILGESLTGKALQD
GLWQLETVDLRQFGIGKHRNVDDTPAGGGAGMVLRADVLGDAIEHTMAGAVGNWPLIYLS
PRGRRMDQALMQDLARCDGVTLLCGRFEGVDERVLQHYGIQEVSLGDFVMTGGEIAAQAM
IDATVRLIPGVLGNQASTEEESFSSGLLEHPQYTRPAEWKGQTIPDVLMSGHHGKIAEWR
QKMSEDITQARRPDLWQAHQDRKKKD