Protein Info for PGA1_c05260 in Phaeobacter inhibens DSM 17395

Annotation: exopolysaccharide production protein ExoY-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 52 to 75 (24 residues), see Phobius details PF02397: Bac_transf" amino acids 47 to 236 (190 residues), 193.6 bits, see alignment E=1.1e-61

Best Hits

Swiss-Prot: 40% identical to EXOY_SINFN: Exopolysaccharide production protein ExoY (exoY) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 66% identity to sit:TM1040_2411)

MetaCyc: 41% identical to undecaprenyl-phosphate galactose phosphotransferase (Sinorhizobium meliloti 1021)
Undecaprenyl-phosphate galactose phosphotransferase. [EC: 2.7.8.6]

Predicted SEED Role

"Bacterial sugar transferase"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.6

Use Curated BLAST to search for 2.7.8.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EJE6 at UniProt or InterPro

Protein Sequence (241 amino acids)

>PGA1_c05260 exopolysaccharide production protein ExoY-like protein (Phaeobacter inhibens DSM 17395)
MNAELSASPASPRRSATGSLKMSPALAGAVGAGMGAGSLGGYATFGKRCLDIALVLLTLP
ISLPLILMAALALWLEGGNPFYTQDRLGQRGRVFSILKLRTMVRDAEQLLERHLASDPAM
RREWDETQKLKEDPRITPVGRFLRTTSLDELPQLWNVLIGEMSLVGPRPMMPDQLPLYGD
ATAYFDLKPGITGLWQVSVRNESGFAVRARADADYHGDLCLRTDVDLIWRTVGVVLRGTG
Y