Protein Info for Psest_0517 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 93 PF04359: DUF493" amino acids 10 to 93 (84 residues), 95.4 bits, see alignment E=1.2e-31

Best Hits

Swiss-Prot: 82% identical to Y844_AZOVD: UPF0250 protein Avin_08440 (Avin_08440) from Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

KEGG orthology group: K09158, hypothetical protein (inferred from 94% identity to psa:PST_3776)

Predicted SEED Role

"Proposed lipoate regulatory protein YbeD" in subsystem Lipoic acid metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GII8 at UniProt or InterPro

Protein Sequence (93 amino acids)

>Psest_0517 Uncharacterized conserved protein (Pseudomonas stutzeri RCH2)
MTDNQDVAAPKIDFPCERYPIKVIGDAGEGFREVVIEVIQRHAPDFDETTVVTRDSRSGR
FLSLQVLITATGVEQLQAIHVDLRATGRVHMVL