Protein Info for Psest_0513 in Pseudomonas stutzeri RCH2

Annotation: rod shape-determining protein RodA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 25 to 49 (25 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 149 to 166 (18 residues), see Phobius details amino acids 172 to 189 (18 residues), see Phobius details amino acids 196 to 214 (19 residues), see Phobius details amino acids 275 to 301 (27 residues), see Phobius details amino acids 317 to 341 (25 residues), see Phobius details amino acids 350 to 371 (22 residues), see Phobius details TIGR02210: rod shape-determining protein RodA" amino acids 28 to 376 (349 residues), 437.8 bits, see alignment E=1.6e-135 PF01098: FTSW_RODA_SPOVE" amino acids 33 to 376 (344 residues), 372.8 bits, see alignment E=8.4e-116

Best Hits

Swiss-Prot: 54% identical to RODA_SHIFL: Peptidoglycan glycosyltransferase MrdB (mrdB) from Shigella flexneri

KEGG orthology group: K05837, rod shape determining protein RodA (inferred from 98% identity to psa:PST_3780)

MetaCyc: 54% identical to peptidoglycan glycosyltransferase MrdB (Escherichia coli K-12 substr. MG1655)
Peptidoglycan glycosyltransferase. [EC: 2.4.1.129]

Predicted SEED Role

"Rod shape-determining protein RodA" in subsystem Bacterial Cytoskeleton or Peptidoglycan Biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.129

Use Curated BLAST to search for 2.4.1.129

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI81 at UniProt or InterPro

Protein Sequence (381 amino acids)

>Psest_0513 rod shape-determining protein RodA (Pseudomonas stutzeri RCH2)
MNGNFDRTLSREDVLRRRASLLQRLHIDGLLLVLLLVLAAGSLFILYSASGKNWDLVIKQ
ATSFGLGLGAMLVIAQLEPRFMARWVPLGYLGVVALLVAVEVVGHTAMGATRWINIPGVI
RFQPSEFMKIIMPMTIAWYLSSRSLPPSIKHTAISLAMILIPFVLILKQPDLGTSLLILA
SGAFVLFIGGLRWRWIISAVAAVVPIAVAMWYFVLRDYQKQRVLTFLDPESDPLGTGWNI
IQSKAAIGSGGVFGKGWLAGTQSHLDFLPESHTDFIIAVLAEEFGLVGVCLLLLVYILLI
TRGLVITVQAQTLFGKLLAGALTMTFFVYVFVNIGMVSGLLPVVGVPLPFISYGGTSLVT
LLSGFGVLMSIHTHRKWIAQV