Protein Info for PGA1_c05180 in Phaeobacter inhibens DSM 17395

Annotation: Predicted small integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 92 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 51 to 68 (18 residues), see Phobius details amino acids 74 to 90 (17 residues), see Phobius details PF09928: DUF2160" amino acids 4 to 92 (89 residues), 118.5 bits, see alignment E=6.7e-39

Best Hits

KEGG orthology group: None (inferred from 86% identity to sit:TM1040_2421)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWN9 at UniProt or InterPro

Protein Sequence (92 amino acids)

>PGA1_c05180 Predicted small integral membrane protein (Phaeobacter inhibens DSM 17395)
MLSWMAWTWPTALVFIGIFSAIGLMIVLEVRSPGGDTRKGVLGLVTTRGDRLFISLLGTS
YIFLAWLGLVGMPLWWPLGLSIAWFAFTFWKV