Protein Info for HP15_494 in Marinobacter adhaerens HP15

Annotation: 6,7-dimethyl-8-ribityllumazine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00114: 6,7-dimethyl-8-ribityllumazine synthase
  • amino acids 17 to 152 (136 residues), 187.3 bits, E=6.6e-60
• PF00885: DMRL_synthase
  • amino acids 17 to 153 (137 residues), 193 bits, E=1.1e-61

Best Hits

Swiss-Prot: 72% identical to RISB_TERTT: 6,7-dimethyl-8-ribityllumazine synthase (ribH) from Teredinibacter turnerae (strain ATCC 39867 / T7901)

KEGG orthology group: K00794, 6,7-dimethyl-8-ribityllumazine synthase [EC: 2.5.1.78] (inferred from 94% identity to maq:Maqu_0845)

MetaCyc: 59% identical to 6,7-dimethyl-8-ribityllumazine synthase (Escherichia coli K-12 substr. MG1655)
LUMAZINESYN-RXN [EC: 2.5.1.78]

Predicted SEED Role

"6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)" (EC 2.5.1.78)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (8/9 steps found)
• flavin biosynthesis III (fungi) (7/9 steps found)
• flavin biosynthesis II (archaea) (5/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.78

Sequence Analysis Tools

See E4PNE0 at UniProt or InterPro

Protein Sequence (158 amino acids)

>HP15_494 6,7-dimethyl-8-ribityllumazine synthase (Marinobacter adhaerens HP15)
MADIRVIEGDFTECSGRYALVVGRFNGFVVESLVEGALDTLRRHGISDDDVTIVRVPGAY
EMPLAVKRVAETGEYDAIIALGAVIRGGTPHFEYVAGEASSGLGAVSLDTDVPVTFGVLT
VDSIEQAIERSGTKAGNKGAEAAITALEMVSLFKKLGE