Protein Info for PGA1_c05160 in Phaeobacter inhibens DSM 17395

Annotation: peptidase M56-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 115 to 140 (26 residues), see Phobius details amino acids 314 to 335 (22 residues), see Phobius details PF05569: Peptidase_M56" amino acids 17 to 275 (259 residues), 62.9 bits, see alignment E=1.5e-21

Best Hits

KEGG orthology group: None (inferred from 59% identity to sil:SPO0615)

Predicted SEED Role

"Regulatory sensor-transducer, BlaR1/MecR1 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EJA9 at UniProt or InterPro

Protein Sequence (383 amino acids)

>PGA1_c05160 peptidase M56-like protein (Phaeobacter inhibens DSM 17395)
MNAESFLNAYIDLNLLLFAGTALWLALRAILTRSRLGPAFRPQLRLLNGMTLLLTLSPML
VVALTTYVVSQPPTLSDMLVSQYLQGNVNMSATRFESILGLREDLVRTLMAQSSLWAQLA
IAALIIGALVSVAQVTLAALRLRASLQQAYVWKHLGGVQIRISDKSTVAFSTRGLFTRYV
VLPSALITNPSDLRLSVAHELQHFRQRDVECEFLLEALRPLLFWNPAYHLWRREVRMLRE
FACDQALMTRGQRDIRAYCECLIRACALAAQDPIRFVQRSPSVALVDRREVRRGATLARR
IDVVTAAQPQDTHLFGWMLVSAMLATGVLATALLMQRPGDWSHDRIMLSTIVNLERMAHR
NAVPETSQTAVTALQGGFMTLSK