Protein Info for Psest_0499 in Pseudomonas stutzeri RCH2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 42 to 58 (17 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 75% identity to psa:PST_3794)

Predicted SEED Role

"FIG00959409: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGH6 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Psest_0499 hypothetical protein (Pseudomonas stutzeri RCH2)
MPVSVITRLPILRALLAQLLALLIVWLLLLGLVGVADMRPSLVVVALAQGCLAALIGARL
GLSAWWLAINLMFVPGLVLLRDFDVPAWLPLGAFILLLLLNWNAFTERVPLYLTGREAER
QLRNRLSELPADFRYIDLGSGLAGSLSRLARDFPAAQFIGVETAPLTFALSWLRCLPRRN
CHIRLLSLWRVDLAEYDVVYCFLSPTPMLALWAKARAEMRPGALLISNSFAVPGIEPVEV
RELNDWRGSRLLIWYPGSTAPDGADTSG