Protein Info for Psest_0498 in Pseudomonas stutzeri RCH2

Annotation: ribosome small subunit-dependent GTPase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 TIGR00157: ribosome small subunit-dependent GTPase A" amino acids 82 to 334 (253 residues), 251.4 bits, see alignment E=4.8e-79 PF03193: RsgA_GTPase" amino acids 104 to 277 (174 residues), 191.5 bits, see alignment E=1.1e-60 PF01926: MMR_HSR1" amino acids 214 to 282 (69 residues), 25.9 bits, see alignment E=8.9e-10

Best Hits

Swiss-Prot: 89% identical to RSGA_PSEMY: Small ribosomal subunit biogenesis GTPase RsgA (rsgA) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K06949, ribosome biogenesis GTPase [EC: 3.6.1.-] (inferred from 95% identity to psa:PST_3795)

Predicted SEED Role

"Ribosome small subunit-stimulated GTPase EngC" in subsystem Universal GTPases

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI72 at UniProt or InterPro

Protein Sequence (343 amino acids)

>Psest_0498 ribosome small subunit-dependent GTPase A (Pseudomonas stutzeri RCH2)
MAKRQLNRRQNWRIEKIQEERAARAARRESRALEELEGGDLGPEQTGLVIAHFGVQVEVE
ALEGEQSGQVFRCHLRANLPALVTGDRVVWRPGNQGIGVIVAQLPRHSELCRPDTRGQLK
PVAANVDLIVIVFAPLPEPHANLIDRYLVAAEHAGITPLLLLNKVDLIDDQNEAALNRLL
EVYRQLNYPLLEVSAHGGGGMDALKERLDGHVSVFVGQSGVGKSSLVNSLLPGVDTRVGA
LSEMTGKGTHTTTTARLFHFPGGGELIDSPGIREFGLGHVSRADVEAGFIEFQDLLGHCR
FRDCKHDREPGCALLQALEDGRIQPQRMSSYRHILSSLPEPDY