Protein Info for PGA1_c00490 in Phaeobacter inhibens DSM 17395

Annotation: ATPases involved in chromosome partitioning

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF10609: ParA" amino acids 2 to 72 (71 residues), 40.6 bits, see alignment E=4.2e-14 PF13614: AAA_31" amino acids 3 to 42 (40 residues), 34.3 bits, see alignment 4.4e-12 PF09140: MipZ" amino acids 3 to 263 (261 residues), 391.2 bits, see alignment E=4.5e-121 PF01656: CbiA" amino acids 5 to 156 (152 residues), 39.5 bits, see alignment E=1e-13

Best Hits

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 89% identity to sit:TM1040_2618)

Predicted SEED Role

"ATPases involved in chromosome partitioning"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ET25 at UniProt or InterPro

Protein Sequence (269 amino acids)

>PGA1_c00490 ATPases involved in chromosome partitioning (Phaeobacter inhibens DSM 17395)
MAHIIVVGNEKGGAGKSTVSMHVATTLARLGYKIAALDLDLRQRSLGRYLENRKAFMEKA
ALELPLVALHELPEIDADSLQPGENVYDHRLSAAVSELEPSNDFILIDCPGSHTRLSQVA
HSLADTLITPLNDSFVDFDLLAHTDQKGEKITGPSVYSEMVWNARQLRAQAGLKPIDWIV
IRNRVGTQRMVNKEKMERAISMLSKRIGFRVAPGFSERVVFRELFPRGLTLLDLKDIGVK
QLNISNIAARQELRDMMKSLNLPGVDVDI