Protein Info for Psest_0492 in Pseudomonas stutzeri RCH2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 613 PF27104: FimW_N" amino acids 30 to 239 (210 residues), 224.9 bits, see alignment E=8.2e-71 PF27125: FimW_C" amino acids 505 to 581 (77 residues), 108.5 bits, see alignment E=1.4e-35

Best Hits

KEGG orthology group: None (inferred from 86% identity to psa:PST_3801)

Predicted SEED Role

"DnaK-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIG6 at UniProt or InterPro

Protein Sequence (613 amino acids)

>Psest_0492 hypothetical protein (Pseudomonas stutzeri RCH2)
MDRQSHHLLLRAPAPTRQSLSFCDASVRGVAGWLAGLPKANIGETARQLYQALIELNQLR
IASETRLQLLELLRPDVHFVCTQLEKHYVNQPIVLSERPRKVAGLCQALQNHLAVGYKLI
VVRVVAQPERDRQQLLSVALQRAIHSLGALLIRSTQLYGPAAPGLWLELHQLYQLAVEQG
TERLLIRDPLARHAQGLSAEQIYLASLLLGCARCNQMRQQSIVKLAAALEAWSAMASVQV
ASVPSSLFLFSPVVDGAPRYRSLFPDRDQQNLLGIDTSMLVEVIDEHLRLAADNRQLTRL
PAATGLDDDLLRHLSSAWGAISERTFQRIPAQGTMTLCIGMTALHYELAGQRPFNEVLEL
PHSSNCAVFKLHNGAADVWANAFDAQSSSAELLPMHDHIEFVRPDLPRPAPATRAKAAAS
AASQRSTTTESYPIYQIQLVDHSPGGYCLAWEGEVPSQLQAGELLGLREGAAQSWSIAVV
RWIRQVRGGSTQMGVQLIAPHAQPCGLRLLRKVDQGSEYLRALLLPEIAAISQPAMLIAP
RLPFQEGHKVQINRNGEEQRAVLDRRRASTGNYNQFEYRTIGQASSGRETPVTGWKGHTT
SGDEDFDSLWKSL