Protein Info for HP15_474 in Marinobacter adhaerens HP15

Annotation: type IV pilus biogenesis protein PilM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 TIGR01175: type IV pilus assembly protein PilM" amino acids 2 to 334 (333 residues), 418.3 bits, see alignment E=1.2e-129 PF11104: PilM_2" amino acids 3 to 331 (329 residues), 445 bits, see alignment E=2.4e-137 PF14450: FtsA" amino acids 185 to 323 (139 residues), 47 bits, see alignment E=5.2e-16

Best Hits

KEGG orthology group: K02662, type IV pilus assembly protein PilM (inferred from 95% identity to maq:Maqu_0826)

Predicted SEED Role

"Type IV pilus biogenesis protein PilM" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PMW0 at UniProt or InterPro

Protein Sequence (338 amino acids)

>HP15_474 type IV pilus biogenesis protein PilM (Marinobacter adhaerens HP15)
MLGVDISSSSVKLLELSKQGDRYKVESYAVEPLPANAVVEKNITDVEAVGEVMKRVASKS
RSGVKQVAVAVSGSAVITKLIQMDGGLNEFEMEDQIALEADQYIPYPLDEVAIDFEVQGP
SESNPDQVDVLLAACRKENVDIREDALEIASLTTKVVDVEAYALERAYALIEPQLDSQGE
ELVVAIVDIGATMTTLSVLAGGKTVYTREQIFGGKQLTEEIQRRYGLSLEEAGLAKKQGG
LPDDYESEVLTPFREAVVQQVARALQFFFGASQYNAVDYVVLAGGTASIQGLTEMVEEKT
GTPTMVANPFADMAVGSKVNASALSNDAPSLRLPAAWQ