Protein Info for PGA1_c04930 in Phaeobacter inhibens DSM 17395

Annotation: tryptophan synthase alpha chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 TIGR00262: tryptophan synthase, alpha subunit" amino acids 8 to 242 (235 residues), 268.3 bits, see alignment E=2.2e-84 PF00290: Trp_syntA" amino acids 8 to 242 (235 residues), 324 bits, see alignment E=2.5e-101

Best Hits

Swiss-Prot: 90% identical to TRPA_RUEPO: Tryptophan synthase alpha chain (trpA) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K01695, tryptophan synthase alpha chain [EC: 4.2.1.20] (inferred from 90% identity to sil:SPO0815)

MetaCyc: 36% identical to tryptophan synthase subunit alpha (Escherichia coli K-12 substr. MG1655)
Tryptophan synthase. [EC: 4.2.1.20]; Indole-3-glycerol-phosphate lyase. [EC: 4.2.1.20, 4.1.2.8]

Predicted SEED Role

"Tryptophan synthase alpha chain (EC 4.2.1.20)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 4.2.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.20

Use Curated BLAST to search for 4.1.2.8 or 4.2.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EU27 at UniProt or InterPro

Protein Sequence (263 amino acids)

>PGA1_c04930 tryptophan synthase alpha chain (Phaeobacter inhibens DSM 17395)
MTRIDAKFAELKAADKKAFVAYVMAGDPDFDTSLELVKGLPAAGVDVIELGLPFTDPMAD
GPTIQLAGQRALEAGMTLQRTLDLARTFREEDNTTPIVMMGYYNPIYSRGVETFLKDAKE
AGIDGLIVVDLPPEEDSELCLPAQQAGLNFIRLATPTTDDKRLPRVLQNTSGFVYYVSIT
GITGAAEAEATNVGPEVARIKSQTDLPVIVGFGINTPEKSQAIASVADGAVVGSAIVSQI
GAGKPVGEVLSFVKSLADGAHSA