Protein Info for PGA1_c04910 in Phaeobacter inhibens DSM 17395

Annotation: 50S ribosomal protein L25

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF01386: Ribosomal_L25p" amino acids 8 to 96 (89 residues), 80.6 bits, see alignment E=9.1e-27 TIGR00731: ribosomal protein bL25, Ctc-form" amino acids 8 to 186 (179 residues), 139.3 bits, see alignment E=5.5e-45 PF14693: Ribosomal_TL5_C" amino acids 104 to 188 (85 residues), 84.6 bits, see alignment E=5e-28

Best Hits

Swiss-Prot: 79% identical to RL25_RUEST: 50S ribosomal protein L25 (rplY) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K02897, large subunit ribosomal protein L25 (inferred from 79% identity to sit:TM1040_0216)

Predicted SEED Role

"LSU ribosomal protein L25p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWM0 at UniProt or InterPro

Protein Sequence (209 amino acids)

>PGA1_c04910 50S ribosomal protein L25 (Phaeobacter inhibens DSM 17395)
MAGQIPDLVCQERTGSGKGAARAARRAGMVPGVVFGGDADPVSIQIPFNELLKKLKAGRF
KSTLWNLKVEGQEDVRVICRDVQRDVVKDLPTHFDLMRLRRTSKVNLFVPVEFINEEEAP
GIKRGGVLTAVRPEVELVVTAGDIPEKLVVDLAGLNVGDTVTISAIKLPEGAKPTIDRDF
VVANISAPSGLKSADNEASDDEAEAAAEE