Protein Info for Psest_0048 in Pseudomonas stutzeri RCH2

Annotation: ABC-type multidrug transport system, ATPase and permease components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 611 transmembrane" amino acids 37 to 65 (29 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 267 to 291 (25 residues), see Phobius details amino acids 296 to 313 (18 residues), see Phobius details PF00664: ABC_membrane" amino acids 42 to 264 (223 residues), 37.2 bits, see alignment E=2.7e-13 PF00005: ABC_tran" amino acids 380 to 533 (154 residues), 117.5 bits, see alignment E=6.9e-38

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 98% identity to psa:PST_4144)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GF69 at UniProt or InterPro

Protein Sequence (611 amino acids)

>Psest_0048 ABC-type multidrug transport system, ATPase and permease components (Pseudomonas stutzeri RCH2)
MLFRRFENLIDVFKPSPDVAPPAGMLRFYAHYLKQVWPLMTAVLVVGFFAALIEVALFSF
LGQLIDMAQATDDARTFFAEHRNELLWMAAVALIIRPLVFGLHNLLTHQAINPGLTNLIR
WQNHRYVLKQSLNFFQNDFAGRIAQRVMQTGPSLRDSAMQVIDALWHVVVYAGSALYLFA
AADLRLIVPLLLWIVGYSAALWYFVPRIRARSAAASAARSKVMGRVVDGYSNVATLKLFA
HSREEESYAREAMQELLGKFRLQSRVITSLDFLITCMNGLLIVGTGALALWLWSEALITT
GAIALALGLVIRINNMAEWIMWVVNGIFENVGTVQDGMKSIVRPRDVLDPEDAEPLQVEQ
GGVRFEDVHFHYGKQGGVISGLSIDIRPGEKIGLVGPSGAGKSTLVNLLLRLYDLESGRI
LIDGQNVAEVSQESLRANVGVVTQDTSLLHRSIRDNLRYGKPDATEEELWAAARKARADE
FIKALDDSQGGLGFEAMVGERGVKLSGGQRQRIAIARVLLKDAPILVLDEATSALDSEVE
AAIQESLDTLMEGKTVIAIAHRLSTIARMDRLVVIDGGQVIETGTHAELIARGGLYARLW
QHQTGGFVGVD