Protein Info for Psest_0482 in Pseudomonas stutzeri RCH2

Updated annotation (from data): yqiA-like hydrolase, affects the cell envelope
Rationale: PFam PF05728.8 (UPF0227). Conserved phenotypes: important for resisting carbenicillin and doxycycline
Original annotation: Predicted esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 PF05728: UPF0227" amino acids 8 to 190 (183 residues), 207.1 bits, see alignment E=2.2e-65 PF12697: Abhydrolase_6" amino acids 44 to 162 (119 residues), 26.5 bits, see alignment E=1e-09

Best Hits

KEGG orthology group: K07000, (no description) (inferred from 90% identity to psa:PST_3811)

Predicted SEED Role

"Putative esterase, FIGfam005057"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIF7 at UniProt or InterPro

Protein Sequence (201 amino acids)

>Psest_0482 yqiA-like hydrolase, affects the cell envelope (Pseudomonas stutzeri RCH2)
MSSDSPSILYIHGLNSSPLSQKASQLSAALEKLGLAERLRVPALHHHPRQAIAQLEACIS
ELGRPLLVGSSLGGYYATHLAERHGLKALLINPAVTPHRRFDGYLGPQTNLYSGEVWELT
EDHVAALAELETAPPQDAERYQVWLQTADETLDYRDAAQFYRGCALRIQAGGDHGFQGFS
ERLPALLAFAGVAPQIWLEQL