Protein Info for PGA1_c04820 in Phaeobacter inhibens DSM 17395

Annotation: cytidylate kinase Cmk

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 PF02224: Cytidylate_kin" amino acids 5 to 46 (42 residues), 41.5 bits, see alignment 1.3e-14 amino acids 64 to 197 (134 residues), 143.8 bits, see alignment E=6.6e-46 PF13207: AAA_17" amino acids 9 to 138 (130 residues), 27 bits, see alignment E=4.8e-10 TIGR00017: cytidylate kinase" amino acids 66 to 196 (131 residues), 137.2 bits, see alignment E=3.1e-44

Best Hits

Swiss-Prot: 66% identical to KCY_DINSH: Cytidylate kinase (cmk) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K00945, cytidylate kinase [EC: 2.7.4.14] (inferred from 76% identity to sit:TM1040_0197)

Predicted SEED Role

"Cytidylate kinase (EC 2.7.4.25)" (EC 2.7.4.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.14 or 2.7.4.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DM51 at UniProt or InterPro

Protein Sequence (201 amino acids)

>PGA1_c04820 cytidylate kinase Cmk (Phaeobacter inhibens DSM 17395)
MSFTVAVDGPAAAGKGTISRAVAAHFGFGHLDTGLLYRAVGARMLAGDKPIDAALALLPD
DLERPELRTAQVAQAASKVAVIAEVRAALVDFQRAFARRAGGAVLDGRDIGTVICPRAQA
KLFVTASAEVRAQRRLQELMAAGNPTSYAEVLEDVKARDARDTNRSESPLKPASDAVLID
TSALTIDEAVATAIAAIDARH