Protein Info for PGA1_c04780 in Phaeobacter inhibens DSM 17395

Annotation: S-adenosylmethionine synthetase MetK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00438: S-AdoMet_synt_N
  • amino acids 5 to 108 (104 residues), 119.2 bits, E=1.5e-38
• TIGR01034: methionine adenosyltransferase
  • amino acids 7 to 392 (386 residues), 490.1 bits, E=2.1e-151
• PF02772: S-AdoMet_synt_M
  • amino acids 121 to 238 (118 residues), 130.5 bits, E=5.5e-42
• PF02773: S-AdoMet_synt_C
  • amino acids 240 to 382 (143 residues), 214.6 bits, E=6.8e-68

Best Hits

Swiss-Prot: 88% identical to METK_RUEPO: S-adenosylmethionine synthase (metK) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 88% identity to sil:SPOA0011)

MetaCyc: 55% identical to methionine adenosyltransferase (Escherichia coli K-12 substr. MG1655)
Methionine adenosyltransferase. [EC: 2.5.1.6]

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• S-adenosyl-L-methionine salvage II (3/3 steps found)
• S-adenosyl-L-methionine biosynthesis (1/1 steps found)
• L-methionine degradation I (to L-homocysteine) (2/3 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (3/5 steps found)
• S-adenosyl-L-methionine salvage I (2/4 steps found)
• ethene biosynthesis I (plants) (1/3 steps found)
• 2'-deoxymugineic acid phytosiderophore biosynthesis (1/4 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (3/7 steps found)
• superpathway of L-methionine salvage and degradation (9/16 steps found)
• L-methionine salvage cycle III (5/11 steps found)
• L-methionine salvage cycle I (bacteria and plants) (4/12 steps found)
• L-methionine salvage cycle II (plants) (2/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.6

Sequence Analysis Tools

See I7EU12 at UniProt or InterPro

Protein Sequence (393 amino acids)

>PGA1_c04780 S-adenosylmethionine synthetase MetK (Phaeobacter inhibens DSM 17395)
MTRTNYTFTSESVSEGHPDKVCDRISDAVLDAFLSEEPEARVAAETFATTNRVVIGGEVG
LSDQDKLHDYMGRIDEIARACIKDIGYEQDKFHHETVEITNLLHEQSAHIAQGVDAAADK
EEGAGDQGIMFGFATNETPALMPAPIQYSHAILRRLAEVRKNGAEPALGPDAKSQLSVVY
ENGKPVRVSSLVLSTQHLDETLTSNDIRAIVEPYFHETLPEGWLTDETIWHVNPTGKFVI
GGPDGDAGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKVDRSAAYAARYLAKNVVAAGLAD
KCTIQLSYAIGVAKPLSIYADTHGTGDVDAAKIEAAIDRIMDLTPRGIRHHLGLNKPIYE
RTAAYGHFGREPDADGGFSWERTDLVEALAKAI