Protein Info for PGA1_c04750 in Phaeobacter inhibens DSM 17395

Annotation: metalloprotein, YbeY/UPF0054 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF02130: YbeY" amino acids 12 to 158 (147 residues), 124.9 bits, see alignment E=1.2e-40 TIGR00043: rRNA maturation RNase YbeY" amino acids 40 to 158 (119 residues), 109.2 bits, see alignment E=5.9e-36

Best Hits

Swiss-Prot: 66% identical to YBEY_RUEPO: Endoribonuclease YbeY (ybeY) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K07042, probable rRNA maturation factor (inferred from 66% identity to sil:SPOA0008)

Predicted SEED Role

"Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DXM7 at UniProt or InterPro

Protein Sequence (176 amino acids)

>PGA1_c04750 metalloprotein, YbeY/UPF0054 family (Phaeobacter inhibens DSM 17395)
MTLDISIEDTRWQDADLTTHAVQAIHAVLGHFGLDADDCELSLLACDDARIMELNTEFRQ
KAKPTNVLSWPAEDLSSEEAGDEPLLPEADFTGEIPLGDIAIAYETCAREAEDAGKSLAD
HLRHLIVHGVLHLLGYDHIRDPDATLMERLEVQILGKMGIDDPYTLDDSPNHGRIG