Protein Info for PGA1_c04660 in Phaeobacter inhibens DSM 17395

Annotation: 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase FabA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 TIGR01749: beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA" amino acids 6 to 168 (163 residues), 260.5 bits, see alignment E=3.5e-82 PF07977: FabA" amino acids 29 to 160 (132 residues), 148 bits, see alignment E=1.3e-47 PF22818: ApeI-like" amino acids 52 to 124 (73 residues), 37 bits, see alignment E=2.8e-13

Best Hits

Swiss-Prot: 66% identical to FABA_CAUSK: 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (fabA) from Caulobacter sp. (strain K31)

KEGG orthology group: K01716, 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [EC: 4.2.1.60] (inferred from 94% identity to sit:TM1040_0182)

MetaCyc: 62% identical to 3-hydroxy-acyl-[acyl-carrier-protein] dehydratase (Agrobacterium fabrum C58)
Trans-2-decenoyl-[acyl-carrier-protein] isomerase. [EC: 5.3.3.14]; 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase. [EC: 5.3.3.14, 4.2.1.59]

Predicted SEED Role

"3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabA form (EC 4.2.1.59)" (EC 4.2.1.59)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.59

Use Curated BLAST to search for 4.2.1.59 or 4.2.1.60 or 5.3.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWK1 at UniProt or InterPro

Protein Sequence (169 amino acids)

>PGA1_c04660 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase FabA (Phaeobacter inhibens DSM 17395)
MADYPSSFDKDDLLKCARGELFGPGNAQLPAPPMLMMDRITDVSADGGAHGKGHITAEFD
ITPELWFFDCHFPGNPIMPGCLGLDGLWQLTGFNLGWRGWQGRGYALGVGEVKLTGMVRP
DRKLLTYKIDFTKAIQTRRLTMGVADGIVEADGEVIYQVKDMKVALSES