Protein Info for PGA1_c04630 in Phaeobacter inhibens DSM 17395

Annotation: 2-nitropropane dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF03060: NMO" amino acids 9 to 352 (344 residues), 241.9 bits, see alignment E=2.4e-75 PF01070: FMN_dh" amino acids 200 to 263 (64 residues), 25.2 bits, see alignment E=1.6e-09 PF01180: DHO_dh" amino acids 203 to 248 (46 residues), 30 bits, see alignment 6.3e-11

Best Hits

Swiss-Prot: 59% identical to NMO_PARPJ: Nitronate monooxygenase (Bphyt_4144) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K00459, nitronate monooxygenase [EC: 1.13.12.16] (inferred from 63% identity to bmu:Bmul_1549)

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [FMN] (EC 1.3.1.9)" in subsystem Fatty Acid Biosynthesis FASII (EC 1.3.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.1.9

Use Curated BLAST to search for 1.13.12.16 or 1.3.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ETZ9 at UniProt or InterPro

Protein Sequence (364 amino acids)

>PGA1_c04630 2-nitropropane dioxygenase (Phaeobacter inhibens DSM 17395)
MSSISTSAALMDRLGISLPILQSPMAGVSTPQMAAAVSNAGGLGALGIGAASVEQAEKML
LQTAALTGRPFNVNVFCHKPATADPVREAGWLQHLSPAFQEFGGKPPQGLREIYTSFCVD
RDMQDMLIAQRPAVVSFHLGLPSQDVIAALKAAGVVLLATATSLAEARSLERAGIDAIVA
QGWEAGGHRGIFDPAGEDGRLQTLPLVRELVGALALPVIAAGGMMTGADIAEALAAGAAA
AQLGTAFIACPESSADAGYRAALLADDPETEMTAVISGRPARCLSNRFTDWGRQNRDAGI
PAYPIAYDAGKALNAAAKNRDEFGYGAQWAGQGAAHARVMPTAELVAMLAQELSVAQRED
RAPE