Protein Info for Psest_0453 in Pseudomonas stutzeri RCH2
Annotation: Glycosyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 51% identical to RFAG_ECOLI: Lipopolysaccharide core biosynthesis protein RfaG (rfaG) from Escherichia coli (strain K12)
KEGG orthology group: K02844, UDP-glucose:(heptosyl)LPS alpha-1,3-glucosyltransferase [EC: 2.4.1.-] (inferred from 90% identity to psa:PST_3847)MetaCyc: 52% identical to lipopolysaccharide glucosyltransferase I (Salmonella enterica enterica serovar Typhimurium str. LT2)
2.4.1.M73 [EC: 2.4.1.M73]
Predicted SEED Role
"UDP-glucose:(heptosyl) LPS alpha1,3-glucosyltransferase WaaG (EC 2.4.1.-)" in subsystem LOS core oligosaccharide biosynthesis (EC 2.4.1.-)
MetaCyc Pathways
- superpathway of Kdo2-lipid A biosynthesis (17/25 steps found)
- lipid A-core biosynthesis (E. coli K-12) (3/10 steps found)
- lipid A-core biosynthesis (Salmonella) (3/10 steps found)
KEGG Metabolic Maps
- Anthocyanin biosynthesis
- Carotenoid biosynthesis - General
- Flavone and flavonol biosynthesis
- Flavonoid biosynthesis
- Fructose and mannose metabolism
- Glycerolipid metabolism
- Glycosphingolipid biosynthesis - ganglio series
- Glycosphingolipid biosynthesis - globo series
- Glycosphingolipid biosynthesis - lacto and neolacto series
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
- High-mannose type N-glycan biosynthesis
- Keratan sulfate biosynthesis
- Lipopolysaccharide biosynthesis
- N-Glycan biosynthesis
- O-Glycan biosynthesis
- O-Mannosyl glycan biosynthesis
- Peptidoglycan biosynthesis
- Sphingolipid metabolism
- Zeatin biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.4.1.-
Use Curated BLAST to search for 2.4.1.- or 2.4.1.M73
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0GI40 at UniProt or InterPro
Protein Sequence (373 amino acids)
>Psest_0453 Glycosyltransferase (Pseudomonas stutzeri RCH2) MQLAFILYKYFPFGGLQRDFMRIALECQRRGHTIRVYAMIWEGDVPDGFEVLIAPVKALF NHTRNERFTAWVEADLSKRPVDRVIGFNKMPGLDVYYAADPCFEDKAQTLRNPIYRRWGR YKHFAEYERAVFAPEAKTEILMISEVQQPLFVKHYGTPAERFHLLPPGIAQDRRAPANAA QIRAEFREEFEVRPDELLLVQIGSGFKTKGVDRSLKALAALPRELSQRTRLLVIGQDDPK PFKLQAKALGVSGMVEFLRGRSDIPRFLLGADLLIHPAYNENTGTVLLEALVAGLPVLVS DVCGYAHYIADADCGRVVPGPFEQSVLDRMLAQMLAEDQQRAAWSRNGLAYAETADLYSM PQKAADVILEERA