Protein Info for HP15_p187g157 in Marinobacter adhaerens HP15

Annotation: fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 52 to 68 (17 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details PF00487: FA_desaturase" amino acids 53 to 284 (232 residues), 127.8 bits, see alignment E=3.2e-41

Best Hits

KEGG orthology group: K05918, [EC: 1.14.19.-] (inferred from 66% identity to abo:ABO_2546)

Predicted SEED Role

"Beta-carotene hydroxylase" in subsystem Carotenoids

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.19.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PSB9 at UniProt or InterPro

Protein Sequence (299 amino acids)

>HP15_p187g157 fatty acid desaturase (Marinobacter adhaerens HP15)
MMQEELTRQNREALAAAHKYMGEPAWLTVVFTVFICAGFIVNLWLFSIGNTPAWLALLFL
AILTYMAYTPLHEAVHGNIHGNIETLRWLNDLCGYLVAPLIAVPYASHRVEHMTHHRYTN
QPEKDPDFIVSRIGNGPWSAFLTVLRFVWVQNTFFVTRHWKTATFGKRLTYLTELTLSIG
WRVIFLSMIDNPSAAAVVLVGYVAGGAFTAYWFAYRPHIPYRETQRYRNTCSLIMPTWMK
PLEWFWLGQNLHSIHHLFPRVPFYRYHALHQDIEYVLRAHGTPILGAFSRQEVQSCKSP