Protein Info for HP15_430 in Marinobacter adhaerens HP15

Annotation: peptidase S33, proline iminopeptidase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 TIGR01249: prolyl aminopeptidase" amino acids 9 to 311 (303 residues), 407.3 bits, see alignment E=2e-126 PF00561: Abhydrolase_1" amino acids 36 to 296 (261 residues), 102 bits, see alignment E=6.4e-33 PF12697: Abhydrolase_6" amino acids 37 to 295 (259 residues), 34.2 bits, see alignment E=6.5e-12 PF12146: Hydrolase_4" amino acids 54 to 293 (240 residues), 40.5 bits, see alignment E=3.1e-14

Best Hits

Swiss-Prot: 54% identical to PIP_XYLFT: Proline iminopeptidase (pip) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)

KEGG orthology group: K01259, proline iminopeptidase [EC: 3.4.11.5] (inferred from 86% identity to maq:Maqu_0771)

Predicted SEED Role

"Proline iminopeptidase (EC 3.4.11.5)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 3.4.11.5)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PMR6 at UniProt or InterPro

Protein Sequence (320 amino acids)

>HP15_430 peptidase S33, proline iminopeptidase 1 (Marinobacter adhaerens HP15)
MLTLYPEIKPNAQHRIAVDPPHELYVEESGNPDGIPVLVVHGGPGGGCEDYHRRFFDAER
FRIILMDQRGAGRSSPLAELEGNSTDKLVEDMEVVRSFLGIDKWLLFGGSWGSTLSLVYA
QAHPERVSGLVLRGIFLCRPRDIHWFYQEGASRVFPDYWSDFEAQIPEAERANMVSAYYR
KLTSSNELEQIQAAKAWSVWEGRCATLHPNPRVVEHFGHPHVAIALARIECHYFMNSAFL
EPDQIIRDAGRLVDIPGIIIHGRYDMVCPLDNALALSEAWPEAEFQIIRDAGHSASEPAI
VDALIRGVESVVAKTDKSAG