Protein Info for HP15_p187g116 in Marinobacter adhaerens HP15

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 45 to 65 (21 residues), see Phobius details amino acids 86 to 111 (26 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PS78 at UniProt or InterPro

Protein Sequence (163 amino acids)

>HP15_p187g116 membrane protein (Marinobacter adhaerens HP15)
MGLVAVTAPLWWLALLDLLLTIAGSEVRLSPSNSIMNAINPVKQALGSWVGFVGSAVGLV
SLRDAGRLQRIHKKYPCSPIRQQVPLIIWMGWHYVFFLLVWLMGSLLPATWLNLLKTVEV
WENTDLLVDTTAAPCELLLIMIGLILGFILASRRRTKLLMFAR