Protein Info for PGA1_c00440 in Phaeobacter inhibens DSM 17395

Annotation: homogentisate 1,2-dioxygenase HmgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 TIGR01015: homogentisate 1,2-dioxygenase" amino acids 22 to 446 (425 residues), 648.8 bits, see alignment E=1.7e-199 PF20510: HgmA_N" amino acids 23 to 293 (271 residues), 378 bits, see alignment E=2.6e-117 PF04209: HgmA_C" amino acids 295 to 446 (152 residues), 237.4 bits, see alignment E=5.7e-75

Best Hits

Swiss-Prot: 68% identical to HGD_SINMW: Homogentisate 1,2-dioxygenase (hmgA) from Sinorhizobium medicae (strain WSM419)

KEGG orthology group: K00451, homogentisate 1,2-dioxygenase [EC: 1.13.11.5] (inferred from 90% identity to sit:TM1040_2621)

Predicted SEED Role

"Homogentisate 1,2-dioxygenase (EC 1.13.11.5)" in subsystem Homogentisate pathway of aromatic compound degradation (EC 1.13.11.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ET20 at UniProt or InterPro

Protein Sequence (453 amino acids)

>PGA1_c00440 homogentisate 1,2-dioxygenase HmgA (Phaeobacter inhibens DSM 17395)
MNHEVDAHEMIQAPSPAGPHTGYMPGFGNDFETEALPGALPQGMNSPQKCNYGLYGEQLS
GTAFTAPSHQNERTWCYRIRPSVKHSHRYTKIDLPYWKSAPNVDPDVISLGQYRWDPVPH
GTEGLTWLTGMRTMTTAGDVNTQVGMASHIYLVTDSMMDSYFYSADSELLVVPQEGRLRF
ATELGIIDIEPQEIAIIPRGLVYRVEVLDGPCRGFVCENYGQKFELPGRGPIGANCMANP
RDFKAPVAAFEDRETPSTVTIKWCGQFHETKIGHSPLDVVAWHGNYTPVKYDLRTYCPVG
AILFDHPDPSIFTVLTAPSGQPGTANIDFVLFRERWMVAEDTFRPPWYHKNIMSELMGNI
YGQYDAKPQGFVPGGVSLHNMMLPHGPDRNAFEGASNADLGPEKLDNTMSFMFETRFPQH
LTPFAANEAPLQDDYIDCWADIEKKFDGTPGKK