Protein Info for PGA1_c04500 in Phaeobacter inhibens DSM 17395

Annotation: transcriptional regulator, AsnC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF13412: HTH_24" amino acids 22 to 69 (48 residues), 68.7 bits, see alignment E=1e-22 PF13404: HTH_AsnC-type" amino acids 22 to 63 (42 residues), 57.3 bits, see alignment E=4.2e-19 PF08279: HTH_11" amino acids 25 to 67 (43 residues), 23.5 bits, see alignment E=1.7e-08 PF01022: HTH_5" amino acids 27 to 69 (43 residues), 23.4 bits, see alignment E=1.8e-08 PF01047: MarR" amino acids 28 to 71 (44 residues), 28 bits, see alignment E=6.4e-10 PF09339: HTH_IclR" amino acids 28 to 70 (43 residues), 28.1 bits, see alignment E=5.8e-10 PF01037: AsnC_trans_reg" amino acids 88 to 162 (75 residues), 70 bits, see alignment E=5.1e-23

Best Hits

Swiss-Prot: 38% identical to BKDR_PSEPU: Bkd operon transcriptional regulator (bkdR) from Pseudomonas putida

KEGG orthology group: None (inferred from 79% identity to sil:SPO0569)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DXK0 at UniProt or InterPro

Protein Sequence (171 amino acids)

>PGA1_c04500 transcriptional regulator, AsnC family (Phaeobacter inhibens DSM 17395)
MNRCFIRADNLENIFMNDGLTLDDRDRRILTLLQRDARMSNADLADAVGMSASALWRRVR
TLEEAGVIERYGAVVNAKAMGLGFHAIVHVQLTRHDRDKLADFIRAVETSHLVQECYATT
GQSDYHLRVLAPDLDAYNRFLEEFLFRLPAVASAQTNVVLRTIKRDEPVAP