Protein Info for Psest_4376 in Pseudomonas stutzeri RCH2

Annotation: RNase P protein component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 PF00825: Ribonuclease_P" amino acids 5 to 112 (108 residues), 109.9 bits, see alignment E=3.3e-36 TIGR00188: ribonuclease P protein component" amino acids 10 to 114 (105 residues), 99 bits, see alignment E=9e-33

Best Hits

Swiss-Prot: 96% identical to RNPA_PSEU5: Ribonuclease P protein component (rnpA) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K03536, ribonuclease P protein component [EC: 3.1.26.5] (inferred from 96% identity to psa:PST_4213)

MetaCyc: 51% identical to RNase P protein component (Escherichia coli K-12 substr. MG1655)
Ribonuclease P. [EC: 3.1.26.5]; 3.1.26.5 [EC: 3.1.26.5]

Predicted SEED Role

"Ribonuclease P protein component (EC 3.1.26.5)" in subsystem tRNA processing (EC 3.1.26.5)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GU58 at UniProt or InterPro

Protein Sequence (131 amino acids)

>Psest_4376 RNase P protein component (Pseudomonas stutzeri RCH2)
MSRGFGREKRLLTPRQFKAVFDSPSGKVPGRNVLLLARENDLQHPRLGLVIGKKSVKLSV
ERNRIKRQIRETFRHHQLELAGWDIVIVARKGLADLDNPELAKQFAKLWKRLSRSPSKTA
VEPGAANSTHA