Protein Info for PGA1_c00430 in Phaeobacter inhibens DSM 17395

Annotation: fumarylacetoacetase Fah

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 TIGR01266: fumarylacetoacetase" amino acids 6 to 412 (407 residues), 496.3 bits, see alignment E=3.6e-153 PF09298: FAA_hydrolase_N" amino acids 21 to 117 (97 residues), 82.4 bits, see alignment E=2.5e-27 PF01557: FAA_hydrolase" amino acids 124 to 408 (285 residues), 145.4 bits, see alignment E=2.1e-46

Best Hits

Swiss-Prot: 48% identical to FAAA_MOUSE: Fumarylacetoacetase (Fah) from Mus musculus

KEGG orthology group: K01555, fumarylacetoacetase [EC: 3.7.1.2] (inferred from 85% identity to sit:TM1040_2622)

Predicted SEED Role

"Fumarylacetoacetase (EC 3.7.1.2)" in subsystem Homogentisate pathway of aromatic compound degradation or Salicylate and gentisate catabolism (EC 3.7.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DL14 at UniProt or InterPro

Protein Sequence (418 amino acids)

>PGA1_c00430 fumarylacetoacetase Fah (Phaeobacter inhibens DSM 17395)
MPLMKSWVSSANSTAHPFPLNNLPYGVFSVDSDDPRCGVAIGDMILDMQAAEETGLIQLG
DVPLFDVPYWNDLMEEGPAVWAALRDRLTALLSEGAAEQEKVEPLLVAASAAELHMPFAV
SEYTDFYAGKNHAFNVGTMFRGPENALPPNWLHIPIGYNGRASSVVASGTDVRRPWGQLK
GPNDDKPRWAPCARFDIELEMGAIVGTPSEGPITVQEADDHIFGYVLLNDWSARDIQAWE
YQPLGPFQAKATANTISPWIVTKAALEPFRCDTPEREVELLDHLKDCGPMLYDIDLEVTM
APEGKEATTIARTNYKEMYYSAAQQLAHHATSGCPMNAGDLLGSGTISGSTKDSRGSLLE
LSWGGKEPLTLDTGEERSFIADGDTLTLKGAAKGDGYTIGFGDCTGTVLAALEDPYAR