Protein Info for Psest_4369 in Pseudomonas stutzeri RCH2

Annotation: Formate hydrogenlyase subunit 3/Multisubunit Na+/H+ antiporter, MnhD subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 36 to 57 (22 residues), see Phobius details amino acids 77 to 102 (26 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 208 to 234 (27 residues), see Phobius details amino acids 244 to 269 (26 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 304 to 325 (22 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 373 to 391 (19 residues), see Phobius details amino acids 411 to 428 (18 residues), see Phobius details amino acids 450 to 470 (21 residues), see Phobius details amino acids 481 to 496 (16 residues), see Phobius details PF10125: NADHdeh_related" amino acids 125 to 230 (106 residues), 40.4 bits, see alignment E=2.3e-14 PF00361: Proton_antipo_M" amino acids 133 to 423 (291 residues), 215.3 bits, see alignment E=1.1e-67

Best Hits

Swiss-Prot: 48% identical to MRPD_BACPE: Na(+)/H(+) antiporter subunit D (mrpD) from Bacillus pseudofirmus (strain OF4)

KEGG orthology group: K05568, multicomponent Na+:H+ antiporter subunit D (inferred from 92% identity to psa:PST_4206)

Predicted SEED Role

"Na(+) H(+) antiporter subunit D" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSQ6 at UniProt or InterPro

Protein Sequence (506 amino acids)

>Psest_4369 Formate hydrogenlyase subunit 3/Multisubunit Na+/H+ antiporter, MnhD subunit (Pseudomonas stutzeri RCH2)
MTEFLILHAPLWPVLLPILGAGLATCLWEHRRAQRLVTGLCITLLLASSLLLLAAVYQQG
VLAIRFGGWDAPFGVVFVADALSAAMVAITGILAAAVMTFGLADIRRREEQAGFHPLMLG
MLAGVNGAFLTGDIFNLYVWFEVMLITAMGLLSIGRNRARLDATVRYAVLNLFSTLLFLT
GVALLYGATGTLNMADLARVLPETEPSINLTLSALLLLCGFGIKAGYFPLFFWLPASYHT
ASITVSAIFAGLLTKVGVYACFRVFTLIFSVEDSGIREIVAVLAAGTMLFGVFGAAVQWD
VRRILSFHIVSQIGYMLLGLAISTQAALAGAIFYIIHHIIVKANLFLLAGAIHRASGTFD
LRKSGGLMYRNPLLAALFLVPALSLAGLPPLSGFWAKFLVIDATFRAGEHWLAGLALFVG
LLTLYSMSKIWMEAFWKKPVLPRAEARRIPLPMLLAIASLGALTLVIGFMPQPLILFSQT
AAAALLEPSAYLSAVLPANPILEPRP