Protein Info for Psest_4366 in Pseudomonas stutzeri RCH2

Annotation: Multisubunit Na+/H+ antiporter, MnhG subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details PF03334: PhaG_MnhG_YufB" amino acids 9 to 88 (80 residues), 79.6 bits, see alignment E=8.3e-27 TIGR01300: monovalent cation/proton antiporter, MnhG/PhaG subunit" amino acids 9 to 95 (87 residues), 68.9 bits, see alignment E=1.9e-23

Best Hits

Predicted SEED Role

"Na(+) H(+) antiporter subunit G" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GU50 at UniProt or InterPro

Protein Sequence (155 amino acids)

>Psest_4366 Multisubunit Na+/H+ antiporter, MnhG subunit (Pseudomonas stutzeri RCH2)
MIEILAVAFMLVGVIFLFAAMFGLLRFADPLQRIHATTKSGTVGAGLILVGVMIEMGDAQ
ATFIGTATVIFLMLTIPIAGHLLGRAAYVSGARLDGLHGDDALDGVLERSPLTLDEYLAQ
TEKSPPQRNPEPGREDLRTNVDEPRSPVDNLGSAK