Protein Info for Psest_4364 in Pseudomonas stutzeri RCH2

Annotation: 16S rRNA (guanine(527)-N(7))-methyltransferase GidB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 PF02527: GidB" amino acids 27 to 208 (182 residues), 214.5 bits, see alignment E=4.1e-68 TIGR00138: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG" amino acids 32 to 212 (181 residues), 194.9 bits, see alignment E=4.9e-62

Best Hits

Swiss-Prot: 91% identical to RSMG_PSEU5: Ribosomal RNA small subunit methyltransferase G (rsmG) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K03501, ribosomal RNA small subunit methyltransferase G [EC: 2.1.1.170] (inferred from 91% identity to psa:PST_4201)

MetaCyc: 50% identical to 16S rRNA m7G527 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11578 [EC: 2.1.1.170]

Predicted SEED Role

"rRNA small subunit 7-methylguanosine (m7G) methyltransferase GidB"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.170

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSQ1 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Psest_4364 16S rRNA (guanine(527)-N(7))-methyltransferase GidB (Pseudomonas stutzeri RCH2)
MSLVSESHAAELVRGAQELGIELSERQQQQLLAYLALLIKWNKAYNLTAVRDPDEMVSRH
LLDSLSVVPFVAEAGRTWLDVGSGGGMPGVPLAIMFPERAFTLLDSNGKKTRFLTQVKLE
LKLANLEVVHSRVEQYQPAIPFEGITSRAFSSLDDFTSWTRHLGNAETRWLAMKGVQPDD
ELQRLPDDFRLDACHVLKVPGCQGQRHLLILRRTS