Protein Info for Psest_4353 in Pseudomonas stutzeri RCH2

Annotation: ATP synthase, F1 epsilon subunit (delta in mitochondria)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 TIGR01216: ATP synthase F1, epsilon subunit" amino acids 4 to 133 (130 residues), 145.8 bits, see alignment E=3.5e-47 PF02823: ATP-synt_DE_N" amino acids 6 to 84 (79 residues), 108.8 bits, see alignment E=1.1e-35 PF00401: ATP-synt_DE" amino acids 88 to 133 (46 residues), 37.1 bits, see alignment E=3e-13

Best Hits

Swiss-Prot: 86% identical to ATPE_PSEMY: ATP synthase epsilon chain (atpC) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K02114, F-type H+-transporting ATPase subunit epsilon [EC: 3.6.3.14] (inferred from 97% identity to psa:PST_4190)

MetaCyc: 54% identical to ATP synthase F1 complex subunit epsilon (Escherichia coli K-12 substr. MG1655)
ATPSYN-RXN [EC: 7.1.2.2]; RXN0-7041 [EC: 7.1.2.2]

Predicted SEED Role

"ATP synthase epsilon chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14 or 7.1.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GS38 at UniProt or InterPro

Protein Sequence (142 amino acids)

>Psest_4353 ATP synthase, F1 epsilon subunit (delta in mitochondria) (Pseudomonas stutzeri RCH2)
MAMTVHCDIVSAEEELFSGLVEMVVAHGNLGDIGVLPGHAPLLTDLKPGPVRVIKQGGDE
EIFYISGGFIEVQPNMVKVLADTATRAKDIDEAAAQAAVKAAEKALHEKGAEFDYGSAAA
RLAEAAAQLRTIEAMRKKYGRH