Protein Info for Psest_4352 in Pseudomonas stutzeri RCH2

Annotation: UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 TIGR01173: UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase" amino acids 4 to 452 (449 residues), 655.8 bits, see alignment E=1.7e-201 PF01128: IspD" amino acids 5 to 130 (126 residues), 31.8 bits, see alignment E=3.9e-11 PF12804: NTP_transf_3" amino acids 6 to 130 (125 residues), 80.1 bits, see alignment E=6.5e-26 PF00483: NTP_transferase" amino acids 6 to 185 (180 residues), 44.3 bits, see alignment E=5.2e-15 PF25087: GMPPB_C" amino acids 261 to 342 (82 residues), 43.1 bits, see alignment E=9.4e-15 PF00132: Hexapep" amino acids 265 to 296 (32 residues), 27.4 bits, see alignment (E = 5.9e-10) amino acids 392 to 425 (34 residues), 27.7 bits, see alignment 4.7e-10 PF14602: Hexapep_2" amino acids 281 to 310 (30 residues), 11.7 bits, see alignment (E = 5.5e-05) amino acids 394 to 425 (32 residues), 24.6 bits, see alignment (E = 4.9e-09)

Best Hits

Swiss-Prot: 94% identical to GLMU_PSEU5: Bifunctional protein GlmU (glmU) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K04042, bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC: 2.3.1.157 2.7.7.23] (inferred from 94% identity to psa:PST_4189)

Predicted SEED Role

"N-acetylglucosamine-1-phosphate uridyltransferase (EC 2.7.7.23) / Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)" in subsystem Peptidoglycan Biosynthesis or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.3.1.157, EC 2.7.7.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.157 or 2.7.7.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GTW7 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Psest_4352 UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (Pseudomonas stutzeri RCH2)
MSLDIVILAAGQGTRMRSALPKVLHPVAGKSMLGHVIDTARALQPQSIQVVIGHGAEQVR
LRLAGDDLDYVVQAEQLGTGHAVAQALPNLSAERVLILYGDVPLIEAETLQRLLQKVGPE
QLALLTVTLDDPTGYGRIVRDARGEVQAIVEHKDASDEQKAIREGNTGILAVPGSRIGEW
LGRLSNSNAQGEYYLTDVIAMAVADGLRVATEQPLDAMEVQGANDRIQLAELERHYQQRA
ARRLMAQGVTLRDPARFDVRGELSVGRDVLIDVNVVLEGTVVIEDDVQIGPNCVIKDSTL
RRGAIIKANSHLEGAVVGEGADCGPFARLRPGAVLGKKAHVGNFVELKNATLGDGAKAGH
LSYLGDAEIGARTNIGAGTITCNYDGANKFKTVMGEDVFIGSNSSLVAPLHLGDGATTGA
GSTITEDVPAHTLGLGRGRQRNIDGWQRPTKK