Protein Info for Psest_4347 in Pseudomonas stutzeri RCH2

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 801 PF00072: Response_reg" amino acids 9 to 110 (102 residues), 54.5 bits, see alignment E=4.3e-18 amino acids 683 to 789 (107 residues), 70.2 bits, see alignment E=5.7e-23 PF00989: PAS" amino acids 149 to 257 (109 residues), 24.8 bits, see alignment E=6.5e-09 PF08447: PAS_3" amino acids 168 to 254 (87 residues), 52.8 bits, see alignment E=1.4e-17 amino acids 307 to 374 (68 residues), 31.4 bits, see alignment E=6.5e-11 TIGR00229: PAS domain S-box protein" amino acids 187 to 266 (80 residues), 31.6 bits, see alignment E=7.6e-12 amino acids 286 to 394 (109 residues), 27.3 bits, see alignment E=1.6e-10 PF13426: PAS_9" amino acids 299 to 389 (91 residues), 15.6 bits, see alignment E=5.8e-06 PF00512: HisKA" amino acids 428 to 495 (68 residues), 37 bits, see alignment E=1e-12 PF02518: HATPase_c" amino acids 538 to 658 (121 residues), 66.2 bits, see alignment E=1.2e-21

Best Hits

KEGG orthology group: None (inferred from 88% identity to psa:PST_4184)

Predicted SEED Role

"PAS/PAC sensor hybrid histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GS33 at UniProt or InterPro

Protein Sequence (801 amino acids)

>Psest_4347 PAS domain S-box (Pseudomonas stutzeri RCH2)
MPASKNISVLFIEDSPHDAELAQLALERSGYTLHTELVYSHAGVVEALQRRSFDLILADF
ILPGFSGSQALQEAQRLAPQTPFIFLSGVFGEEHAVNMMRSGAVDYVLKQKLGFLPKAVE
RALAEVNERRRRLQAEQALREVEVRARLAIDAARLGMWDYEPQSDTLIWDERCRAMLEVD
TQTPVDMPLFESLCHPDDRERIRDQVAGAISGENAGEFCTTYRVLFKDGSLRWMETRGQA
FFEGGQCTRFVGVVMDITEQQLATQTLKQQNETLGERVQQRTRERDRTWELSRDLLAVTD
LEMMPVALNPMWELAFDFPLEQLMQHSLTWLVHPDDLQATREENTRVSRGRVANRFVNRM
RHRDGSYRWLSWSLVADGGRIYSAARDITSEIAAVDKLAEANRELRAQIQERERVEATLQ
QMQRLEAVGQLTAGVAHDFNNLLTVILTSASFLQNDLEQGAPAERSLRRLQYIRESGERG
ATLTSQLLAFARRQQLTPTAIDLNDTLVSLLSLLKSTLGGSVSIETDTQANIWHALVDPT
QIEMIILNLAINARDAMGDSGRLTLGTRNVVITEPALRAEDPSPGEYVVLSVTDTGTGMS
EEVLSKAFEPFFTTKEVGKGSGLGLAQVFGFAKQSGGGARIESRPGAGTTVKVFLPRTEP
PAATEPTAALSAGSQEDNSQHRILLVDDDHAVREVTAQMLQNLGFAVIEADSGEHALQLL
GEGIEVDLLLADFAMPGMNGGELARAVRVGQPELPVIFVTGYAELCELGLVGYSIIQKPF
REDQLANKIHLALREGSLTDG