Protein Info for Psest_0431 in Pseudomonas stutzeri RCH2

Annotation: Lactate dehydrogenase and related dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF00389: 2-Hacid_dh" amino acids 6 to 326 (321 residues), 87.2 bits, see alignment E=1.2e-28 PF02826: 2-Hacid_dh_C" amino acids 110 to 294 (185 residues), 163 bits, see alignment E=7.3e-52 PF03446: NAD_binding_2" amino acids 147 to 235 (89 residues), 23.5 bits, see alignment E=7.6e-09

Best Hits

Swiss-Prot: 99% identical to PTXD_PSEST: Phosphonate dehydrogenase (ptxD) from Pseudomonas stutzeri

KEGG orthology group: None (inferred from 99% identity to tgr:Tgr7_0911)

MetaCyc: 99% identical to phosphonate dehydrogenase monomer (Stutzerimonas stutzeri)
Phosphonate dehydrogenase. [EC: 1.20.1.1]

Predicted SEED Role

"Phosphonate dehydrogenase (EC 1.20.1.1) (NAD-dependent phosphite dehydrogenase)" (EC 1.20.1.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.20.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIB4 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Psest_0431 Lactate dehydrogenase and related dehydrogenases (Pseudomonas stutzeri RCH2)
MLPKLVITHRVHDEILQLLAPHCELMTNQTDSTLPREEILRRCRDAQAMMAFMPDRVDAD
FLQACPELRVVGCALKGFDNFDVDACTARGVWLTFVPDLLTVPTAELAIGLAVGLGRHLR
AADAFVRSGKFQGWQPQFYGTGLDNATVGILGMGAIGLAMADRLQGWGATLQYHEAKALD
TQTEQRLGLRRVACSELFASSDFILLALPLNADTQHLVNAELLALVRPGALLVNPCRGSV
VDEAAVLAALERGQLGGYAADVFEMEDWARADRPRLIDPALLAHPNTLFTPHIGSAVRAV
RLEIERCAAQNIIQALAGARPINAANRLPKAEPAAC