Protein Info for PGA1_c04380 in Phaeobacter inhibens DSM 17395

Annotation: putative colanic acid biosynthesis glycosyltransferase WcaL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 PF00534: Glycos_transf_1" amino acids 226 to 391 (166 residues), 99.7 bits, see alignment E=2.2e-32 PF13692: Glyco_trans_1_4" amino acids 237 to 379 (143 residues), 89.1 bits, see alignment E=5.1e-29 PF13524: Glyco_trans_1_2" amino acids 291 to 399 (109 residues), 28.6 bits, see alignment E=1.9e-10

Best Hits

KEGG orthology group: None (inferred from 77% identity to sit:TM1040_3689)

Predicted SEED Role

"Glycosyl transferase, group 1 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ETX3 at UniProt or InterPro

Protein Sequence (419 amino acids)

>PGA1_c04380 putative colanic acid biosynthesis glycosyltransferase WcaL (Phaeobacter inhibens DSM 17395)
MTTGPSEPSRPPLAVVVKGWPRLSETFIAQELVALEAAGHQFEIWSLRHPTDVKRHPLHE
KLTAAVHYLPEYLHQEPDRVWAARDQAQAMPGYQTAYRIWREDLRRNPTRNRIRRFGQAC
VLAAEMPDAVLGLYAHFLHTPSSVARYAAIMRGLPWSFSAHAKDIWTSPDWELQEKLAAK
SQGATFGATCTGFGAKHLQDMADRSDRVDLIYHGLDLSRFPSPPQRKWRAPGDPLHLMSV
GRLVEKKGFDRLIGALALLPGGLDWHWTHIGGGDMRDLLQGIAEDVGVADRITWRGACDQ
PEVIAAMRACDLFVLPSRIARDGDRDGLPNVLMEAASQRLPILSTAVSAIPEFIESGTHG
LLSEDTPEALAEAILTLSRNPEQAARMAEAALGRLRSDFGMDPGIARLSERLHQMMRNT