Protein Info for Psest_4342 in Pseudomonas stutzeri RCH2

Annotation: Putative GTPases (G3E family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF02492: cobW" amino acids 12 to 173 (162 residues), 129.7 bits, see alignment E=5e-42

Best Hits

KEGG orthology group: None (inferred from 74% identity to psa:PST_4179)

Predicted SEED Role

"Putative metal chaperone, involved in Zn homeostasis, GTPase of COG0523 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GS28 at UniProt or InterPro

Protein Sequence (328 amino acids)

>Psest_4342 Putative GTPases (G3E family) (Pseudomonas stutzeri RCH2)
MRTIAAMLEHIPTHLIAGPLGAGKTSLIRDLLSQKPADERWAVLINEFGQIGLDAALLST
GADGITLAEIPGGCLCCVNGVPFQVGLGRLLRQARPDRLLIEPSGLGHPAELLRQLSQAP
WQTVLAVQPTVLVLDADGLSRGLPLPDSQQQALADAGLLLMNKSESLDEAARAALSGRLP
RCPLFWTRHGRLPIAKLPGIEVRASEQSQAVVLPTGAASLPQVWLDPTRAICQVQATPEN
WSIGWRWHPSQRFDLEAIAQWLAQWPWRRAKLVVQGCSGWQSANALDGEALVFSPSEWRR
DSRIELIFAEPQPQAELESAMEGCRIRA