Protein Info for Psest_4334 in Pseudomonas stutzeri RCH2
Annotation: protoheme IX farnesyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 98% identical to CYOE_PSEU5: Protoheme IX farnesyltransferase (cyoE) from Pseudomonas stutzeri (strain A1501)
KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 98% identity to psa:PST_4171)MetaCyc: 34% identical to heme O synthase (Escherichia coli K-12 substr. MG1655)
HEMEOSYN-RXN [EC: 2.5.1.141]
Predicted SEED Role
"Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative copper metallochaperone" in subsystem Biogenesis of cytochrome c oxidases
MetaCyc Pathways
- heme a biosynthesis (2/4 steps found)
KEGG Metabolic Maps
- Biosynthesis of terpenoids and steroids
- Carotenoid biosynthesis - General
- Methionine metabolism
- Porphyrin and chlorophyll metabolism
- Riboflavin metabolism
- Terpenoid biosynthesis
- Tryptophan metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.5.1.-
Use Curated BLAST to search for 2.5.1.- or 2.5.1.141
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0GPW7 at UniProt or InterPro
Protein Sequence (299 amino acids)
>Psest_4334 protoheme IX farnesyltransferase (Pseudomonas stutzeri RCH2) MATLLSERSAQASWRDYLELTKPKVVLLMLITSLVGMFLATRAGVPWTVLLFGNLGIALC AGGAAAVNHVVDRQIDSVMARTHKRPLAEGRVSPAAALTFAFVLGVSGLALLLTFTNALA AWLTLASLIGYAVIYTGFLKRATPQNIVIGGLAGAAPPLLGWVAVTGQVTAEPLLLVLII FAWTPPHFWALAIHRKDEYAKVNVPMLPVTHGVHYTKVHILLYTVMLLAVSFMPFAIHMS GPLYLAAATVLGARFLYWAIALYRDSRPHAAIKTFKFSIWYLFALFIALLVDHYLLLDF