Protein Info for Psest_4329 in Pseudomonas stutzeri RCH2

Annotation: Heme/copper-type cytochrome/quinol oxidase, subunit 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 231 to 261 (31 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details PF00510: COX3" amino acids 9 to 111 (103 residues), 42.7 bits, see alignment E=3.4e-15 amino acids 158 to 297 (140 residues), 148.2 bits, see alignment E=2.1e-47

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 97% identity to psa:PST_4166)

MetaCyc: 74% identical to cytochrome c oxidase subunit 3 (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPW2 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Psest_4329 Heme/copper-type cytochrome/quinol oxidase, subunit 3 (Pseudomonas stutzeri RCH2)
MSQQTTHEQYYVPDQSKWPIIATVALLVTFYGLGSWFNDLKAGRDESSGPMIFFVGALLI
AYMMFGWFGAVVKESRAGLYSAQMDRSFRWGMSWFIFSEVMFFLAFFGALFYIRYWAGPW
LAGEGDKGVSNMLWPGFEYSWPLLNNPDPKLYPAPEGTISAWGLPLINTILLVSSSFTLT
WAHHALRKNNRQHLKIGLALTVLLGAAFLILQIEEYVHAYTELGLTLGSGIYGATFFMLT
GFHGAHVTMGAIILTVMLVRILRGHFSPEQHFGFEAAAWYWHFVDVVWIALFVFVYVI