Protein Info for HP15_p42g16 in Marinobacter adhaerens HP15

Annotation: conjugal transfer protein TraO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF18790: KfrB" amino acids 91 to 143 (53 residues), 63.8 bits, see alignment E=5.9e-22

Best Hits

Predicted SEED Role

"IncP-type DNA transfer protein TraO"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRS6 at UniProt or InterPro

Protein Sequence (154 amino acids)

>HP15_p42g16 conjugal transfer protein TraO (Marinobacter adhaerens HP15)
MTDFPGQNASRPRLVAEVGFFVGGDFATSSSRRKHKGAPQMKQRLLVMNGQRIVQTDQGG
AWANQKVDKAGALKPGIYNLYMAKEADKSQRHDGVIVHADNNKIYQQIGKNFVMHSKSDF
DIVPDIGSAKSISYDAQGKALVAQAVKLSRGRSR